PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa011706
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ARR-B
Protein Properties Length: 585aa    MW: 64208.9 Da    PI: 6.1721
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58693698PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.81e-27215268155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr++W  eLH++Fv av+qL G++kA+Pk+il+lm+v+g+t+e+v+SHLQkYRl
  Lsa011706 215 KPRVVWCVELHQQFVAAVNQL-GIDKAVPKKILDLMNVPGITRENVASHLQKYRL 268
                79*******************.********************************8 PP

2Response_reg79.41.2e-26291371109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l++ +y ev+ +  +e al ll+e++  +D+++ D+ mp+mdG++ll +i  e  +lp+i+++a ++++ + + +  Ga 
     Lsa011706  29 VLVVDDDPTCLMILEKMLRNCKY-EVTKCNRAEVALSLLRENKngFDVVISDVHMPDMDGFKLLVHIGLEM-DLPVIMMSADDSKSVVMKGVTHGAC 123
                   89*********************.***************999999**********************6654.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l++
     Lsa011706 124 DYLIKPVRIEALRN 137
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.6E-1656579IPR017053Response regulator B-type, plant
SuperFamilySSF521721.04E-3526149IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.2E-4226163No hitNo description
SMARTSM004485.9E-3027139IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.64528143IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.1E-2429137IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.25E-2730142No hitNo description
SuperFamilySSF466898.96E-19213272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-29214273IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23215268IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MPSSSSVSRN STAGGDSNVP DQFPAGLRVL VVDDDPTCLM ILEKMLRNCK YEVTKCNRAE  60
VALSLLRENK NGFDVVISDV HMPDMDGFKL LVHIGLEMDL PVIMMSADDS KSVVMKGVTH  120
GACDYLIKPV RIEALRNIWQ HVVRKKKREW KDIDTSASLD DVDRKEEKQA EDPDYSSSAN  180
EGHNWKNTKR RKDDEDEGEG EGEGEERDDS SSLKKPRVVW CVELHQQFVA AVNQLGIDKA  240
VPKKILDLMN VPGITRENVA SHLQKYRLYL RRLSGSHQSG GNTPSFFSTP DAGYGSISTL  300
SDLEIQALAA SGQLGQLGQL PGQSLATLQA AALGRSGYSK SPISVPLIDQ RNIFSFENPQ  360
SRYGQVQNRQ GHNGNITRPM NLLHGIPTTM EPKQLVGMQG SFAGLTSQGL IPMTGQSQNH  420
GSRQPVLPGQ VVSSPGNHVT ESTGNRFQLR GNLGIPSYGL VNNGNQIQTR PLQGADLTFD  480
PSHHMNKNMH GGLNVLQHNN YDSGQKIGGN KVIFSTGEGS GTHVVDDSSM LKAEKVNYKS  540
TFCPEEYSQD DLLTAMFTQQ QQQEGIGQGE NELGLDWYSL DNLPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-23211274164ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275142.20.0PREDICTED: two-component response regulator ARR1 isoform X1
SwissprotQ940D01e-164ARR1_ARATH; Two-component response regulator ARR1
TrEMBLA0A103XT810.0A0A103XT81_CYNCS; CheY-like superfamily
STRINGVIT_05s0077g01480.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.11e-148response regulator 1